Sequence 1: | NP_476623.1 | Gene: | l(1)sc / 30983 | FlyBaseID: | FBgn0002561 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005574.2 | Gene: | LYL1 / 4066 | HGNCID: | 6734 | Length: | 280 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 57/206 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LLQHQHHHQTQQHQLIAPKIPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYN---NMPYGEQLPS 84
Fly 85 VARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQ 146
Fly 147 DMLDDGTAS----------STRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYH 201
Fly 202 SASPTPSYSGS 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(1)sc | NP_476623.1 | HLH | <96..146 | CDD:278439 | 16/49 (33%) |
Peptidase_C11 | <128..218 | CDD:304483 | 24/95 (25%) | ||
LYL1 | NP_005574.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..60 | ||
HLH | 156..208 | CDD:197674 | 23/61 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..280 | 11/66 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |