DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and LYL1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_005574.2 Gene:LYL1 / 4066 HGNCID:6734 Length:280 Species:Homo sapiens


Alignment Length:206 Identity:53/206 - (25%)
Similarity:77/206 - (37%) Gaps:57/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLQHQHHHQTQQHQLIAPKIPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYN---NMPYGEQLPS 84
            |..|.|.|.......|.|..|.              ::.|  ||:.|:...:   ::..|.|...
Human   100 LALHYHPHPFLNSVYIGPAGPF--------------SIFP--SSRLKRRPSHCELDLAEGHQPQK 148

  Fly    85 VARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQ 146
            ||||   |:|||.|.:.||..|..||:.||.          ....:||||.:.||:|::||..|.
Human   149 VARRVFTNSRERWRQQNVNGAFAELRKLLPT----------HPPDRKLSKNEVLRLAMKYIGFLV 203

  Fly   147 DMLDDGTAS----------STRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYH 201
            .:|.|..|:          ..|.::...|:.:..||...               |..:|:|....
Human   204 RLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRR---------------AEAAARSQPAP 253

  Fly   202 SASPTPSYSGS 212
            .|.|..|..|:
Human   254 PADPDGSPGGA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 24/95 (25%)
LYL1NP_005574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
HLH 156..208 CDD:197674 23/61 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..280 11/66 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.