DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and HLH54F

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:149 Identity:43/149 - (28%)
Similarity:69/149 - (46%) Gaps:35/149 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PSVARR--NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145
            |.|.|.  |||||.|::.:::.:..|:..||....::          ||||:||||:|..||:.|
  Fly    29 PPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDT----------KLSKLDTLRLATLYIKQL 83

  Fly   146 QDMLDDGTAS-----------STRHIYNSADES----------SNDGSSYNDYNDSLDSSQQFLT 189
            ...::.|:.|           |..|.::|...|          |:.|.:||.:|:....|..|  
  Fly    84 ITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPF-- 146

  Fly   190 GATQSAQSHSYHSASPTPS 208
            ...||::|.::..:|.|.|
  Fly   147 EFHQSSRSLAFAPSSSTTS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 31/102 (30%)
HLH54FNP_477302.1 HLH 32..83 CDD:278439 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.