DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and MSGN1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:72 Identity:23/72 - (31%)
Similarity:38/72 - (52%) Gaps:11/72 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145
            ||.||   :.||:.|::.:.:....||.:||...      ..||  :.|:|:.||:..::||..|
Human   122 SVQRRRKASEREKLRMRTLADALHTLRNYLPPVY------SQRG--QPLTKIQTLKYTIKYIGEL 178

  Fly   146 QDMLDDG 152
            .|:|:.|
Human   179 TDLLNRG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 12/49 (24%)
Peptidase_C11 <128..218 CDD:304483 10/25 (40%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59
HLH 125..179 CDD:278439 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.