DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and CG33557

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:116 Identity:34/116 - (29%)
Similarity:54/116 - (46%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QNMQQSQQSNVGPMLSSQKKKFNYNNMPYGEQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTV 114
            ::.|..|::|.|    .|:.:.|:...|..:::      |||||.|...||:.:..||..:|...
  Fly    38 EDSQIGQEANPG----GQENQGNHRRRPPRQKI------NARERYRTFNVNSAYEALRNLIPTEP 92

  Fly   115 VNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASS--TRHIYNS 163
            :|          :||||::.:|:|..||..|...|:.||...  ..|.|.|
  Fly    93 MN----------RKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKYES 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 15/38 (39%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.