DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Tal1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus


Alignment Length:204 Identity:52/204 - (25%)
Similarity:76/204 - (37%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LIAPKIPLGTSQLQNMQQSQQS---------NVGPMLSSQKKKFNYNN------MPYGEQL---- 82
            |.||..| |.:.|.::.|...|         :..||       |..||      .||..::    
  Rat   126 LAAPAGP-GRALLYSLSQPLASLGSGFFGEPDAFPM-------FTNNNRVKRRPSPYEMEITDGP 182

  Fly    83 -PSVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIR 143
             ..|.||   |:|||.|.:.||..|..||:.:|.          ....|||||.:.||:|::||.
  Rat   183 HTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPT----------HPPDKKLSKNEILRLAMKYIN 237

  Fly   144 GLQDMLDDGTASSTRHIYNSADE-------SSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYH 201
            .|..:|:|.....|:......|.       .:..|....|....:.|.......:...|.|...:
  Rat   238 FLAKLLNDQEEEGTQRAKPGKDPMVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPDSY 302

  Fly   202 SASPTPSYS 210
            :..|||.::
  Rat   303 TEEPTPKHT 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 22/90 (24%)
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.