DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and ac

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:180 Identity:75/180 - (41%)
Similarity:99/180 - (55%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNG----GRGSSKKLSKVDTLRIAVEYIR 143
            |||.|||||||||||||||||..||||:|..|:..||||    |.|::||||||.||::||||||
  Fly    24 PSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIR 88

  Fly   144 GLQDML--DDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPT 206
            .||.:|  :|.......|:..............:.|....:...|..||:|.|..|.|.:....|
  Fly    89 RLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPAT 153

  Fly   207 PSYSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEELLDYISSWQE 256
            .:..|:......:.|.|...:|.:.:|..|.:    :||::|||||.||:
  Fly   154 STIPGATPPNNFHTKLEASFEDYRNNSCSSGT----EDEDILDYISLWQD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 34/53 (64%)
Peptidase_C11 <128..218 CDD:304483 28/91 (31%)
acNP_476824.1 HLH 30..96 CDD:197674 44/65 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467875
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm6567
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X2717
1110.930

Return to query results.
Submit another query.