DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Mesp1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001101001.1 Gene:Mesp1 / 308766 RGDID:1311751 Length:242 Species:Rattus norvegicus


Alignment Length:86 Identity:26/86 - (30%)
Similarity:44/86 - (51%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YGEQLPSVARRNA--RERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVE 140
            :|.:|.|..|::|  ||:.|::.:......||:.||.:|.....|        |:|::|||:|:.
  Rat    69 HGSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPIGQN--------LTKIETLRLAIR 125

  Fly   141 YIRGLQDM--LDDGTASSTRH 159
            ||..|..:  |.:.:....||
  Rat   126 YIGHLSAVLGLSEDSLRQQRH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 12/34 (35%)
Mesp1NP_001101001.1 HLH 77..130 CDD:278439 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.