DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl4

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_038935995.1 Gene:Ascl4 / 299687 RGDID:1307533 Length:145 Species:Rattus norvegicus


Alignment Length:101 Identity:37/101 - (36%)
Similarity:57/101 - (56%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PYGEQLPSVAR-RNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVE 140
            |.|...|:..| ||.|||.||:.||.|:..||||||:.:          :.::||||:|||.|:.
  Rat    52 PGGVAEPAFLRQRNERERQRVRCVNEGYARLRQHLPREL----------AGQRLSKVETLRAAIG 106

  Fly   141 YIRGLQDMLDDGTASSTRH---IYNSADESSNDGSS 173
            ||:.||::|:       ||   :.:..:..::.|:|
  Rat   107 YIKQLQELLE-------RHRPDLNSDGESKASSGAS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 20/49 (41%)
Peptidase_C11 <128..218 CDD:304483 17/49 (35%)
Ascl4XP_038935995.1 bHLH_SF 57..116 CDD:412148 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.