DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Mesp2

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:163 Identity:43/163 - (26%)
Similarity:67/163 - (41%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGPMLSSQKKKFNYNNMPYGEQLPSVARRNA---RERNRVKQVNNGFVNLRQHLPQTVVNSLSN 120
            :.||..|::..:...|........|:..:|.:   ||:.|::.:......||:.||.:|.     
  Rat    54 STGPARSARNTQVAPNAPRRARPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVA----- 113

  Fly   121 GGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADES-SNDGSSYNDYNDSLDSS 184
               .:.:.|:|::|||:|:.||..|..:|.....|..|....|||.: |:......|  ||..|.
  Rat   114 ---PAGQSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRRRSADAAFSHRCPQCPD--DSSPSQ 173

  Fly   185 QQFLTGATQSAQSHSYHSASPTPSYSGSEISGG 217
            .|.|                 .||. ||:||.|
  Rat   174 AQML-----------------GPSL-GSDISSG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 13/49 (27%)
Peptidase_C11 <128..218 CDD:304483 29/91 (32%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.