DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Nhlh1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099440.1 Gene:Nhlh1 / 289230 RGDID:1310261 Length:133 Species:Rattus norvegicus


Alignment Length:119 Identity:33/119 - (27%)
Similarity:48/119 - (40%) Gaps:44/119 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYNNMPYGEQLPSVARRNA----------RERNRV 96
            :.||.|..:::|.         ||.::::               .||.|          |||.||
  Rat    48 LELGESGRKDLQH---------LSREERR---------------RRRRATAKYRTAHATRERIRV 88

  Fly    97 KQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLD 150
            :..|..|..||:.||..          ...|||||::.||:|:.||..|..:||
  Rat    89 EAFNLAFAELRKLLPTL----------PPDKKLSKIEILRLAICYISYLNHVLD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 17/49 (35%)
Peptidase_C11 <128..218 CDD:304483 12/23 (52%)
Nhlh1NP_001099440.1 bHLH_TS_HEN1 61..132 CDD:381544 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.