DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Fer1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:126 Identity:32/126 - (25%)
Similarity:52/126 - (41%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGT 153
            |.|||.|::.:|..|..||.|:|....          .|:|||||||::|:.||..|.:|:    
  Fly    92 NLRERRRMQSINEAFEGLRTHIPTLPY----------EKRLSKVDTLKLAISYITFLSEMV---- 142

  Fly   154 ASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSYSGSEI 214
                     ..|::.|:.......|...:..::.:........:||.........|.||::
  Fly   143 ---------KKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 17/49 (35%)
Peptidase_C11 <128..218 CDD:304483 20/87 (23%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.