Sequence 1: | NP_476623.1 | Gene: | l(1)sc / 30983 | FlyBaseID: | FBgn0002561 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_835455.1 | Gene: | PTF1A / 256297 | HGNCID: | 23734 | Length: | 328 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 81/196 - (41%) | Gaps: | 52/196 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRG 144
Fly 145 LQDM------LDDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSA 203
Fly 204 SPT-PSYSGSEISGGGYI---KQELQEQDL-------------KFDSFDSFSDEQPDDEELLDYI 251
Fly 252 S 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(1)sc | NP_476623.1 | HLH | <96..146 | CDD:278439 | 18/49 (37%) |
Peptidase_C11 | <128..218 | CDD:304483 | 26/96 (27%) | ||
PTF1A | NP_835455.1 | HLH | 165..220 | CDD:238036 | 25/66 (38%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..278 | 5/23 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..328 | 5/24 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |