DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl3

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001258163.1 Gene:Ascl3 / 246301 RGDID:621631 Length:174 Species:Rattus norvegicus


Alignment Length:78 Identity:33/78 - (42%)
Similarity:44/78 - (56%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NYNNMPYGEQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLR 136
            ||....|......:.:||.|||.|||.||.|:..||:|||:..:          .|:||||:|||
  Rat    81 NYRRCDYTYGPAFIRKRNERERQRVKCVNEGYARLRRHLPEDYL----------EKRLSKVETLR 135

  Fly   137 IAVEYIRGLQDML 149
            .|::||..||.:|
  Rat   136 AAIKYISYLQSLL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 21/49 (43%)
Peptidase_C11 <128..218 CDD:304483 13/22 (59%)
Ascl3NP_001258163.1 bHLH_TS_ASCL3 90..148 CDD:381588 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.