DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl5

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001257538.1 Gene:Ascl5 / 226439 MGIID:2685043 Length:188 Species:Mus musculus


Alignment Length:144 Identity:46/144 - (31%)
Similarity:64/144 - (44%) Gaps:46/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDML 149
            :.:||.|||.|||.||.|:..||.|||          |..:.|:||||:|||.|:.||:.||::|
Mouse    82 IQKRNERERQRVKCVNEGYARLRGHLP----------GALTEKRLSKVETLRAAIRYIKYLQELL 136

  Fly   150 DDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPS-----Y 209
                            .::.||:.               ..||....:|:.||..|.||     .
Mouse   137 ----------------SATPDGAP---------------PPATSPPPAHTGHSNVPQPSSLVAES 170

  Fly   210 SGSEISGGGYIKQE 223
            |||..|...:::.|
Mouse   171 SGSPFSSSPFLESE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 22/49 (45%)
Peptidase_C11 <128..218 CDD:304483 27/94 (29%)
Ascl5NP_001257538.1 HLH 86..136 CDD:197674 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.