DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and hlh-6

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_496070.1 Gene:hlh-6 / 188539 WormBaseID:WBGene00001952 Length:268 Species:Caenorhabditis elegans


Alignment Length:240 Identity:72/240 - (30%)
Similarity:97/240 - (40%) Gaps:90/240 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQHYQ--LTNSNIFLLQHQHHHQTQQHQLIAPKI---------------PLGT---SQLQ----- 50
            |.|.|  :.|:|:.|    .:.||...:|:.|.|               |:.|   ||||     
 Worm    45 QNHIQTSIPNTNLLL----ENVQTDVQKLMVPLIDQQFHIPTSTPLQLAPIPTQIQSQLQPQISQ 105

  Fly    51 ----NMQQSQ-QSNVGPMLSSQK-----------------KKFNYNNMP-------------YGE 80
                |..|.| ||.|.|.|.:|.                 ||:.....|             ||.
 Worm   106 IPIHNQPQIQIQSQVQPQLPTQSQPKPSSKASLDTSSNAFKKYVNPFAPEATVPLPVELEDQYGP 170

  Fly    81 QLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145
            ...||.:||.|||.||:.||:|:..||:|||.          ....|::|||||||:|:.||:.|
 Worm   171 YSSSVWKRNERERCRVRNVNDGYERLRKHLPV----------HFDEKRISKVDTLRLAIRYIKHL 225

  Fly   146 QDMLDDGTASSTRHIYNS------ADESSN----DGSSYNDYNDS 180
            .::|     .|..|.||.      .:||..    |.|::| :|.|
 Worm   226 DNLL-----RSELHQYNCKCFNGFQEESEGNILIDISTFN-FNSS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 20/49 (41%)
Peptidase_C11 <128..218 CDD:304483 23/63 (37%)
hlh-6NP_496070.1 HLH 179..231 CDD:197674 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4001
Isobase 1 0.950 - 0 Normalized mean entropy S5951
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.