DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and hlh-19

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_508119.2 Gene:hlh-19 / 186449 WormBaseID:WBGene00001962 Length:111 Species:Caenorhabditis elegans


Alignment Length:86 Identity:31/86 - (36%)
Similarity:42/86 - (48%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDD 151
            |.|||||.|.|.:.|.|..||.|||:.:          ..:|.||.:||:.|.:||..|..:|:.
 Worm     5 RANARERCRQKSIGNAFNMLRNHLPKQL----------RDRKPSKAETLKSAAQYISHLLRILEK 59

  Fly   152 GTASSTRHIYNSADESSNDGS 172
            ...:|:.   |..||...|.|
 Worm    60 EIENSSN---NLKDEHQKDPS 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 16/45 (36%)
hlh-19NP_508119.2 bHLH_TS_FIGLA 3..58 CDD:381428 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114727
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.