DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Nhlh1

DIOPT Version :10

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_035046.1 Gene:Nhlh1 / 18071 MGIID:98481 Length:133 Species:Mus musculus


Alignment Length:60 Identity:24/60 - (40%)
Similarity:31/60 - (51%) Gaps:10/60 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLD 150
            |||.||:..|..|..||:.||..          ...|||||::.||:|:.||..|..:||
Mouse    83 RERIRVEAFNLAFAELRKLLPTL----------PPDKKLSKIEILRLAICYISYLNHVLD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 bHLH_TS_dAS-C_like 94..149 CDD:381587 19/54 (35%)
Nhlh1NP_035046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
bHLH_TS_HEN1 61..132 CDD:381544 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.