DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Msc

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_011236650.1 Gene:Msc / 17681 MGIID:1333884 Length:217 Species:Mus musculus


Alignment Length:144 Identity:36/144 - (25%)
Similarity:54/144 - (37%) Gaps:46/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDML-DDG 152
            |||||.|::.::..|..|:..||....::          ||||:||||:|..||..|:.:| :|.
Mouse   108 NARERARMRVLSKAFSRLKTSLPWVPPDT----------KLSKLDTLRLASSYIAHLRQLLQEDR 162

  Fly   153 TASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSYSGSEISGG 217
            ...|..|..|                         |.|..:|....|.....|.|          
Mouse   163 YEDSYVHPVN-------------------------LVGMLRSRPGDSSPERYPGP---------- 192

  Fly   218 GYIKQELQEQDLKF 231
            |..:.:.:.|:.:|
Mouse   193 GLARPQTKSQEGRF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 15/49 (31%)
Peptidase_C11 <128..218 CDD:304483 23/90 (26%)
MscXP_011236650.1 bHLH_TS_musculin 100..165 CDD:381546 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.