DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl2

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:281 Identity:76/281 - (27%)
Similarity:110/281 - (39%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CSSKFQQQHYQLTNSNIFLLQH---QHHHQTQQHQLIA---------------PKIPLGTSQLQN 51
            |||...:..   ..:|:....|   :.|......:|:|               |::...:|.:..
Mouse    25 CSSALPEAR---EGANVHFPPHPVPREHFSCAAPELVAGAQGLNASLMDGGALPRLMPTSSGVAG 86

  Fly    52 MQQSQQSNVGPMLSSQKKKFNYNNMPYGEQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVN 116
            ...:::....|.|....::.............:|||||.|||||||.||.||..||||:|.    
Mouse    87 ACAARRRQASPELLRCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPH---- 147

  Fly   117 SLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYNDSL 181
                  .|::||||||:|||.||||||.||.:|.:          :.|..::..|..........
Mouse   148 ------GGANKKLSKVETLRSAVEYIRALQRLLAE----------HDAVRAALAGGLLTPATPPS 196

  Fly   182 DSSQQFLTGATQSAQSHSYHSASPTP-------------SYSGSEISGGGYIKQELQEQDLKFDS 233
            |...|  ..|:.::.|.|..|.||:|             :||..|.|..|.:             
Mouse   197 DECAQ--PSASPASASLSCASTSPSPDRLGCSEPTSPRSAYSSEESSCEGEL------------- 246

  Fly   234 FDSFSDEQPDDEELLDYISSW 254
                   .|.::||||: |||
Mouse   247 -------SPMEQELLDF-SSW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 27/49 (55%)
Peptidase_C11 <128..218 CDD:304483 32/102 (31%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 5/21 (24%)
HLH 134..176 CDD:197674 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848573
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.