DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:106/241 - (43%) Gaps:76/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QQHQLIAPKIPLGTSQLQNMQQSQQSNVG---------------PMLSSQKKKFNYNNMPYG--- 79
            ||.|..||  |....||..:..||.|..|               |.|...|::.|::...|.   
Mouse    47 QQQQPQAP--PQQAPQLSPVADSQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQ 109

  Fly    80 EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRG 144
            :|..:|||||.|||||||.||.||..||:|:|        ||  .::||:|||:|||.||||||.
Mouse   110 QQPAAVARRNERERNRVKLVNLGFATLREHVP--------NG--AANKKMSKVETLRSAVEYIRA 164

  Fly   145 LQDMLDDGTASSTRHIYNSADESSNDGSSY-NDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPS 208
            ||.:||:..|.|.  .:.:...|.....:| ||.|..                     :.||..|
Mouse   165 LQQLLDEHDAVSA--AFQAGVLSPTISPNYSNDLNSM---------------------AGSPVSS 206

  Fly   209 YSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEELLDYISSW 254
            ||..|                  .|:|..|   |:::||||: ::|
Mouse   207 YSSDE------------------GSYDPLS---PEEQELLDF-TNW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 26/49 (53%)
Peptidase_C11 <128..218 CDD:304483 30/90 (33%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 13/46 (28%)
HLH 129..171 CDD:197674 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.960

Return to query results.
Submit another query.