Sequence 1: | NP_476623.1 | Gene: | l(1)sc / 30983 | FlyBaseID: | FBgn0002561 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032239.1 | Gene: | Hand1 / 15110 | MGIID: | 103577 | Length: | 216 | Species: | Mus musculus |
Alignment Length: | 222 | Identity: | 45/222 - (20%) |
---|---|---|---|
Similarity: | 71/222 - (31%) | Gaps: | 83/222 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 HQHHHQTQQHQLI-----------------------------APKIPLGTSQLQNMQQSQQSNVG 61
Fly 62 PMLSSQKKKFNY------NNMP-----YGEQLPSVARRNA---RERNRVKQVNNGFVNLRQHLPQ 112
Fly 113 TVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDY 177
Fly 178 NDSLDSSQQFLTGATQSAQSHSYHSAS 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(1)sc | NP_476623.1 | HLH | <96..146 | CDD:278439 | 15/49 (31%) |
Peptidase_C11 | <128..218 | CDD:304483 | 20/77 (26%) | ||
Hand1 | NP_032239.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 4/8 (50%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 53..109 | 15/72 (21%) | |||
HLH | 103..152 | CDD:197674 | 21/71 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..203 | 5/28 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |