DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Hand1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:222 Identity:45/222 - (20%)
Similarity:71/222 - (31%) Gaps:83/222 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HQHHHQTQQHQLI-----------------------------APKIPLGTSQLQNMQQSQQSNVG 61
            |.|||....|.::                             ||..|.|               |
Mouse    11 HHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAG---------------G 60

  Fly    62 PMLSSQKKKFNY------NNMP-----YGEQLPSVARRNA---RERNRVKQVNNGFVNLRQHLPQ 112
            |..::......|      :..|     .|.:||.  |:.:   :||.|.:.:|:.|..||:.:|.
Mouse    61 PPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPK--RKGSGPKKERRRTESINSAFAELRECIPN 123

  Fly   113 TVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDY 177
            ...::          ||||:.|||:|..||..|.|:|             :.|..:.|..::...
Mouse   124 VPADT----------KLSKIKTLRLATSYIAYLMDVL-------------AKDAQAGDPEAFKAE 165

  Fly   178 NDSLDSSQQFLTGATQSAQSHSYHSAS 204
            ....|..::.........|..|:..||
Mouse   166 LKKTDGGRESKRKRELPQQPESFPPAS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 15/49 (31%)
Peptidase_C11 <128..218 CDD:304483 20/77 (26%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 15/72 (21%)
HLH 103..152 CDD:197674 21/71 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.