DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and TCF23

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_786951.1 Gene:TCF23 / 150921 HGNCID:18602 Length:214 Species:Homo sapiens


Alignment Length:221 Identity:49/221 - (22%)
Similarity:76/221 - (34%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HHQTQQHQLIAPKIPLGTSQLQNMQQS------------QQSNVGPMLSSQKKKFNYNNMPYG-- 79
            |.|||....:.|......|:|...:|.            .::..||      :......:..|  
Human    17 HSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATPGP------RGTRAGGLALGRS 75

  Fly    80 EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYI-- 142
            |..|..|   ||||:||:.:...|:.|:..||....::          ||||:|.|.:|..||  
Human    76 EASPENA---ARERSRVRTLRQAFLALQAALPAVPPDT----------KLSKLDVLVLAASYIAH 127

  Fly   143 ------------------RGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLT 189
                              |||:.:...........:|..       |..|:|    |||:    |
Human   128 LTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAG-------GLGYSD----LDST----T 177

  Fly   190 GATQSAQSHSYHSASPTPSYSGSEIS 215
            .:|.|.::......|..|..:.:.:|
Human   178 ASTPSQRTRDAEVGSQVPGEADALLS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/69 (23%)
Peptidase_C11 <128..218 CDD:304483 25/108 (23%)
TCF23NP_786951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 16/77 (21%)
HLH 83..132 CDD:197674 19/58 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.