DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(1)sc and MESP2

DIOPT Version :9

Sequence 1:	NP_476623.1	Gene:	l(1)sc / 30983	FlyBaseID:	FBgn0002561	Length:	257	Species:	Drosophila melanogaster
Sequence 2:	NP_001035047.1	Gene:	MESP2 / 145873	HGNCID:	29659	Length:	397	Species:	Homo sapiens

Alignment Length:	73	Identity:	24/73 - (32%)
Similarity:	38/73 - (52%)	Gaps:	11/73 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    77 PYGEQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEY 141
            |.|.|..|.:.   ||:.|::.:......||:.||.    ||:..|    :.|:|::|||:|:.|
Human    78 PAGGQRQSASE---REKLRMRTLARALHELRRFLPP----SLAPAG----QSLTKIETLRLAIRY 131

  Fly   142 IRGLQDML 149
            |..|..:|
Human   132 IGHLSAVL 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(1)sc	NP_476623.1	HLH	<96..146	CDD:278439	15/49 (31%)
l(1)sc	NP_476623.1	Peptidase_C11	<128..218	CDD:304483	10/22 (45%)
MESP2	NP_001035047.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	28..92		6/16 (38%)
		HLH	82..135	CDD:278439	20/63 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..208
		13 X 2 AA tandem repeats of G-Q	179..204
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	222..295
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	351..376
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4029
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810