DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and ASCL4

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens


Alignment Length:137 Identity:42/137 - (30%)
Similarity:61/137 - (44%) Gaps:47/137 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLD- 150
            :||.|||.||:.||.|:..||.|||:.:          :.|:||||:|||.|::||:.||::|: 
Human    76 KRNERERQRVRCVNEGYARLRDHLPREL----------ADKRLSKVETLRAAIDYIKHLQELLER 130

  Fly   151 -----DGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSYS 210
                 :|.|.:   :.....|.::||.|                            .||..||.|
Human   131 QAWGLEGAAGA---VPQRRAECNSDGES----------------------------KASSAPSPS 164

  Fly   211 GSEISGG 217
            .....||
Human   165 SEPEEGG 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 20/49 (41%)
Peptidase_C11 <128..218 CDD:304483 26/96 (27%)
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:412148 28/62 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.