powered by:
Protein Alignment l(1)sc and ASCL4
DIOPT Version :9
Sequence 1: | NP_476623.1 |
Gene: | l(1)sc / 30983 |
FlyBaseID: | FBgn0002561 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_982260.3 |
Gene: | ASCL4 / 121549 |
HGNCID: | 24311 |
Length: | 172 |
Species: | Homo sapiens |
Alignment Length: | 137 |
Identity: | 42/137 - (30%) |
Similarity: | 61/137 - (44%) |
Gaps: | 47/137 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 RRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLD- 150
:||.|||.||:.||.|:..||.|||:.: :.|:||||:|||.|::||:.||::|:
Human 76 KRNERERQRVRCVNEGYARLRDHLPREL----------ADKRLSKVETLRAAIDYIKHLQELLER 130
Fly 151 -----DGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSYS 210
:|.|.: :.....|.::||.| .||..||.|
Human 131 QAWGLEGAAGA---VPQRRAECNSDGES----------------------------KASSAPSPS 164
Fly 211 GSEISGG 217
.....||
Human 165 SEPEEGG 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm41464 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3926 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.