DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ptf1a

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:77/200 - (38%) Gaps:76/200 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRG 144
            :||...|  |.|||.|::.:|:.|..||.|:|....          .|:||||||||:|:.||..
  Rat   161 QQLRQAA--NVRERRRMQSINDAFEGLRSHIPTLPY----------EKRLSKVDTLRLAIGYINF 213

  Fly   145 LQDMLD-------DGTA-----SSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQS 197
            |.:::.       .||.     ..:||:  ..|...|                       |:.:.
  Rat   214 LSELVQADLPLRGSGTGGCGGPGGSRHL--GGDSPGN-----------------------QAQKV 253

  Fly   198 HSYH--SASPTPS--------YSGSEISGGGYIKQELQEQD---------------LKFDSFDSF 237
            ...|  :.||:||        .:|..:|...  :::|:||:               |...|||:.
  Rat   254 IICHRGTRSPSPSDPDYGLPPLAGHSLSWAD--EKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNI 316

  Fly   238 SDEQP 242
            .:|.|
  Rat   317 ENEPP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 18/49 (37%)
Peptidase_C11 <128..218 CDD:304483 26/111 (23%)
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 25/65 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249 5/44 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.