Sequence 1: | NP_476623.1 | Gene: | l(1)sc / 30983 | FlyBaseID: | FBgn0002561 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004913964.2 | Gene: | ascl3 / 100490616 | XenbaseID: | XB-GENE-6257824 | Length: | 193 | Species: | Xenopus tropicalis |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 56/206 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LIAPKIPLGTSQLQNMQQSQQS---------------------NVGPMLSSQKKKFNYNN----- 75
Fly 76 ----MPYGEQL--------PS-VARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSK 127
Fly 128 KLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYND--YNDSLDSSQQFLTG 190
Fly 191 ATQSAQSHSYH 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(1)sc | NP_476623.1 | HLH | <96..146 | CDD:278439 | 22/49 (45%) |
Peptidase_C11 | <128..218 | CDD:304483 | 25/76 (33%) | ||
ascl3 | XP_004913964.2 | bHLH_SF | 80..143 | CDD:412148 | 31/72 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm14093 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |