DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and ascl3

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_004913964.2 Gene:ascl3 / 100490616 XenbaseID:XB-GENE-6257824 Length:193 Species:Xenopus tropicalis


Alignment Length:206 Identity:55/206 - (26%)
Similarity:89/206 - (43%) Gaps:56/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LIAPKIPLGTSQLQNMQQSQQS---------------------NVGPMLSSQKKKFNYNN----- 75
            :|:|.:.||.::.::|..|.|:                     ...|:.......|:.::     
 Frog     1 MISPALTLGDNKRESMDNSGQNMFFNTVSVHSVTLPWGFYMDHQQAPLREQYGIAFHVDSSCWGG 65

  Fly    76 ----MPYGEQL--------PS-VARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSK 127
                :|:..||        |: :.:||.|||.||:.||.|:..||||||..:          :.|
 Frog    66 RHTYIPFQNQLGLCDYSSEPAFIRKRNERERERVRCVNEGYARLRQHLPLEL----------AEK 120

  Fly   128 KLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYND--YNDSLDSSQQFLTG 190
            :||||:|||.|:|||:.||::||.||....     ..:..||..:|.:.  |..:..|.|:....
 Frog   121 RLSKVETLRAAIEYIKHLQNILDLGTLRPP-----VTEPFSNTETSISPVLYLSTKSSIQRHCAM 180

  Fly   191 ATQSAQSHSYH 201
            .:...:.|..|
 Frog   181 GSPCTEEHQLH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 22/49 (45%)
Peptidase_C11 <128..218 CDD:304483 25/76 (33%)
ascl3XP_004913964.2 bHLH_SF 80..143 CDD:412148 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14093
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.