DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and mespab

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001252512.1 Gene:mespab / 100006128 ZFINID:ZDB-GENE-090817-2 Length:240 Species:Danio rerio


Alignment Length:194 Identity:42/194 - (21%)
Similarity:76/194 - (39%) Gaps:46/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QSQQSNVGPMLSSQKKKFNYNNMPYGEQLPSVARRNA--RERNRVKQVNNGFVNLRQHLPQTVVN 116
            |:::..:...:.|:::..:.|        |.:.|::|  ||:.|::.:.....:||..||.:|. 
Zfish    67 QAKKLKLALPVDSKRRSRSKN--------PGMKRQSASEREKLRMRDLTKALHHLRSFLPPSVA- 122

  Fly   117 SLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYN---SADESSNDGSSYNDYN 178
                   .:.:.|:|::|||:|:.||..|.|.|......:    |.   ||:.|....|.....|
Zfish   123 -------PAGQTLTKIETLRLAISYISHLSDQLRQAEVPN----YEMCCSAEASDRFQSGLVFEN 176

  Fly   179 DSLDSSQQFLTGATQSAQSHSYHSASPT-PSYSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQ 241
            ..:|..|..:....|..         || .|:..|.           ::.:..|.:...|.|.|
Zfish   177 VCMDGQQGLMQDNVQYC---------PTLTSFGDSR-----------EQMENSFPATSHFRDAQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 13/49 (27%)
Peptidase_C11 <128..218 CDD:304483 24/93 (26%)
mespabNP_001252512.1 HLH 91..144 CDD:278439 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.