DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and AT1G71200

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001322926.1 Gene:AT1G71200 / 843460 AraportID:AT1G71200 Length:262 Species:Arabidopsis thaliana


Alignment Length:275 Identity:54/275 - (19%)
Similarity:92/275 - (33%) Gaps:98/275 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PAPYNVDQSQS----VQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKV- 149
            |..:.||.|.|    .|..||:||.|..:::.|:..|...:|..             ....||| 
plant    47 PVLHEVDGSSSGAAKKQDHNAKERLRRMRLHASYLTLGTLLPDH-------------SSSSSKVL 98

  Fly   150 -DTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNT 213
             ..|.:.|.|:..:.:|                 .:....|.....|:.|...:...:....||.
plant    99 FSLLLLQVRYVLLVVEL-----------------YITFLADWQKKWSAPSIIDNVITYIPKLQNE 146

  Fly   214 ISVSPLQQQQ--QLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFNSS 276
            :....|::|:  :|:|:..:.:.::.|.|           |::|                     
plant   147 VGELTLRKQKLVELERRGPSIRAISVLEL-----------GESG--------------------- 179

  Fly   277 MSFDSGTYEGVPQQISTHLDRLDHLDNELH------------THSQL--QLKFEPYE-HFQLDEE 326
                   ||.| .||....:..|...|.||            :.||:  :.:...|. |.::||:
plant   180 -------YEAV-VQICLKKENEDEFSNLLHVMEVQGLSVLSASTSQVCREQRVVCYNFHVKMDEK 236

  Fly   327 DCTPDDEEILDYISL 341
            .|..|     |||::
plant   237 PCEGD-----DYITV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 14/59 (24%)
AT1G71200NP_001322926.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.