DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and AT1G12540

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_172715.4 Gene:AT1G12540 / 837810 AraportID:AT1G12540 Length:257 Species:Arabidopsis thaliana


Alignment Length:279 Identity:56/279 - (20%)
Similarity:90/279 - (32%) Gaps:101/279 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGS 88
            |.:.|..:|:: .:|...|....:...|.:|.               |......:.::|.:..|.
plant    21 FSSLITPSTRV-SFQEPKPCNPVIHSAGIEND---------------GRQNCETTMTLSEIMKGD 69

  Fly    89 SPAPYNVDQSQSVQRRNAR-ERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTL 152
                   |:.::.:.::.. ||.|.::..:.|..||..:|...|    ||       |.|..|.:
plant    70 -------DEPKNKRAKHKELERQRRQENTSLFKILRYLLPSQYI----KG-------KRSSADHV 116

  Fly   153 RIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSS----------SSTCSSSGHN 207
            ..||.||:.||..:.:            |::.:..:..|.:|.||          |||||..|..
plant   117 LEAVNYIKDLQKKIKE------------VSEKRDRIKRSITHPSSRGEFSIRSLASSTCSCVGDT 169

  Fly   208 TYYQNTISVSP------------------LQQQQQL--QRQQFNHQPLTALSLNTNLVGTSVPGG 252
            ..   .:.|.|                  |....||  |.|.||                     
plant   170 NI---AVVVRPCLIGLEIVVSCCNRHESCLSSVLQLLAQEQCFN--------------------- 210

  Fly   253 DAGCVSTSKNQQTCHSPTS 271
            ...|:||..:|...|:..|
plant   211 IVSCISTRLHQGFIHTIAS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 17/58 (29%)
AT1G12540NP_172715.4 HLH 75..127 CDD:278439 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.