DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and AT1G10585

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_563873.2 Gene:AT1G10585 / 837600 AraportID:AT1G10585 Length:181 Species:Arabidopsis thaliana


Alignment Length:169 Identity:28/169 - (16%)
Similarity:66/169 - (39%) Gaps:57/169 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKI----------SKVDTLRIAV 156
            ::||.||::|..::.:.|:.|..|:              .|.:|:          |.:..|:..|
plant    17 EQRNLREKDRRMRMKHLFSILSSHV--------------SPTRKLPVPHLIDQATSYMIQLKENV 67

  Fly   157 EYIRR-----LQDLVDDLNGGS------NIGANNAVTQLQLCLD----------------ESSSH 194
            .|::.     ||..:.:|..||      :|.:.::..::.|.:|                |..:.
plant    68 NYLKEKKRTLLQGELGNLYEGSFLLPKLSIRSRDSTIEMNLIMDLNMKRVMLHELVSIFEEEGAQ 132

  Fly   195 SSSSSTCSSSGHNTY------YQNTISVSPLQQQQQLQR 227
            ..|::..:.:...||      ..:.|.:.|.:.::::::
plant   133 VMSANLQNLNDRTTYTIIAQAIISRIGIDPSRIEERVRK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 13/72 (18%)
AT1G10585NP_563873.2 HLH 12..67 CDD:320748 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.