DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and AT5G51780

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001331036.1 Gene:AT5G51780 / 835252 AraportID:AT5G51780 Length:197 Species:Arabidopsis thaliana


Alignment Length:114 Identity:33/114 - (28%)
Similarity:52/114 - (45%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGR 140
            ||::    |:.|:.    |.|..:.:.|..  ||.|.:::.:.:|.||..:|...|    ||   
plant    11 RCTK----LTCGTD----NNDMEKMMHRET--ERQRRQEMASLYASLRSLLPLHFI----KG--- 58

  Fly   141 GPHKKISKVDTLRIAVEYIRRLQDLV-------DD---LNGGSNIGANN 179
                |.|..|.:..||.||:.||..:       ||   |:.||.:|::|
plant    59 ----KRSTSDQVNEAVNYIKYLQRKIKELSVRRDDLMVLSRGSLLGSSN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 17/57 (30%)
AT5G51780NP_001331036.1 bHLH_AtORG2_like 25..101 CDD:381484 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.