DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ascl4

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:77/161 - (47%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRV 112
            :|...:..|.|.:|.:    .|..:::.:.:...:...|.||.....|.:...:::||.|||.||
Mouse    12 LPSALRTAPLGALPGR----EPCRVSVRQDAADCARRRPYSSLPLGGVAEPAFLRQRNERERQRV 72

  Fly   113 KQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVD----DLNGGS 173
            :.||..:||||||:|:.:           ..:::|||:|||.|:.||::||:|::    |.|.  
Mouse    73 RCVNEGYARLRQHLPREL-----------AGQRLSKVETLRAAISYIKQLQELLERHRPDCNS-- 124

  Fly   174 NIGANNAVTQLQLCLDESSSHSSSSSTCSSS 204
                           |..|..||.:|.||.|
Mouse   125 ---------------DGESKASSGASPCSES 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/57 (42%)
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.