DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ASCL5

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001257530.1 Gene:ASCL5 / 647219 HGNCID:33169 Length:206 Species:Homo sapiens


Alignment Length:206 Identity:56/206 - (27%)
Similarity:76/206 - (36%) Gaps:78/206 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IMPAP--SPLIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVD------ 96
            :||.|  :||.|.    :|.|.:|.                    .|.||.:..|| .|      
Human    25 VMPPPRQAPLPPA----EPLGNVPF--------------------LLYPGPAEPPY-YDAYAGVF 64

  Fly    97 ----------------QSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKK 145
                            :...:|:||.|||.|||.||..:||||.|:|           |....|:
Human    65 PYVPFPGAFGVYEYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLP-----------GALAEKR 118

  Fly   146 ISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLC------------------LDESS 192
            :|||:|||.|:.||:.||:|:.....||...|:..:.....|                  ...|.
Human   119 LSKVETLRAAIRYIKYLQELLSSAPDGSTPPASRGLPGTGPCPAPPATPRPDRPGDGEARAPSSL 183

  Fly   193 SHSSSSSTCSS 203
            ...||.|:|.|
Human   184 VPESSESSCFS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 26/57 (46%)
ASCL5NP_001257530.1 HLH 89..141 CDD:197674 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.