Sequence 1: | NP_476803.1 | Gene: | sc / 30982 | FlyBaseID: | FBgn0004170 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061140.1 | Gene: | MESP1 / 55897 | HGNCID: | 29658 | Length: | 268 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 72/206 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPA--GTMPIKTRKYTPRGMALTRCS 78
Fly 79 ESVSSLSPGSSPAPYNVDQSQSVQRRNA--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRG 141
Fly 142 PHKKISKVDTLRIAVEYIRRLQDLV----DDL--------NGGSNIGANNAVTQLQLCLDESSSH 194
Fly 195 SSSSSTCSSSG 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sc | NP_476803.1 | HLH | 105..163 | CDD:278439 | 16/59 (27%) |
MESP1 | NP_061140.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 17..93 | 22/97 (23%) | |
bHLH_TS_Mesp | 83..147 | CDD:381508 | 19/72 (26%) | ||
CPLCP | 163..167 | 1/10 (10%) | |||
2 X 2 AA tandem repeats of G-Q | 182..185 | 1/3 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |