DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and MESP1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens


Alignment Length:206 Identity:44/206 - (21%)
Similarity:80/206 - (38%) Gaps:72/206 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPA--GTMPIKTRKYTPRGMALTRCS 78
            |::|:.:::.:|              ||.||:.      .||  ||:      ..||..::.|..
Human    35 SLVSSPDSWGST--------------PADSPVA------SPARPGTL------RDPRAPSVGRRG 73

  Fly    79 ESVSSLSPGSSPAPYNVDQSQSVQRRNA--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRG 141
            ...|.|..|              ||::|  ||:.|::.:..:...||:.:|.|:    ...|   
Human    74 ARSSRLGSG--------------QRQSASEREKLRMRTLARALHELRRFLPPSV----APAG--- 117

  Fly   142 PHKKISKVDTLRIAVEYIRRLQDLV----DDL--------NGGSNIGANNAVTQLQLCLDESSSH 194
              :.::|::|||:|:.||..|..::    :.|        :.||..|.       .||.|:..:.
Human   118 --QSLTKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGC-------PLCPDDCPAQ 173

  Fly   195 SSSSSTCSSSG 205
            ..:.:.....|
Human   174 MQTRTQAEGQG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 16/59 (27%)
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 22/97 (23%)
bHLH_TS_Mesp 83..147 CDD:381508 19/72 (26%)
CPLCP 163..167 1/10 (10%)
2 X 2 AA tandem repeats of G-Q 182..185 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.