DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and mespb

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001016653.1 Gene:mespb / 549407 XenbaseID:XB-GENE-970939 Length:292 Species:Xenopus tropicalis


Alignment Length:298 Identity:63/298 - (21%)
Similarity:103/298 - (34%) Gaps:97/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SESVSSLSPGSS-----------------------PAPY--------------------NVDQSQ 99
            ||..|||||.||                       ||.|                    |..:..
 Frog    30 SEGYSSLSPASSSDSSGQSPPYMPYIASQEIFVNIPAAYGQAACQRRGLRHDADKRGKKNTGKLP 94

  Fly   100 SVQRRNA--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGP-HKKISKVDTLRIAVEYIRR 161
            ..||::|  ||:.|::.::.:...||:::|.|:          .| .|.::|::||::.:.||..
 Frog    95 YSQRQSASEREKLRMRNLSKALQNLRRYLPPSV----------APLDKTLTKIETLQLTISYISH 149

  Fly   162 LQDLVDDLNGGSNIGANNAV-TQLQLCLDESSSHSSSS-STCSSSGHNTYYQNTISVSPLQQQQQ 224
            |         .:.:|....: ||.:|...:.::...|. |.|....|.      :..:|      
 Frog   150 L---------SAQLGLTEEILTQRRLAETQRTNLCPSGFSCCMDPTHR------LCTTP------ 193

  Fly   225 LQRQQFN--HQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSP---TSSFNSSMSFDSGTY 284
             :...||  ..|....|...........|.:|.|      ||:|.:|   .....|....|..|.
 Frog   194 -EEDHFNPAATPTMPFSEARCYPEPGYHGREAVC------QQSCETPLQLKQEITSPQYADPSTM 251

  Fly   285 -EGVPQQISTHLDRLDHLDN-----ELHTHSQLQLKFE 316
             :.|.||..|.|....|.::     ::....|||.:.:
 Frog   252 AKPVRQQCITGLQHTIHCEDYYNLADIWRRDQLQAQMD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 15/60 (25%)
mespbNP_001016653.1 HLH 97..150 CDD:278439 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.