DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and mycn

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001006874.1 Gene:mycn / 448649 XenbaseID:XB-GENE-478859 Length:445 Species:Xenopus tropicalis


Alignment Length:173 Identity:45/173 - (26%)
Similarity:71/173 - (41%) Gaps:36/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KNNNNTTKS-TTMSSSVLSTNETFPTTINSATKIF-------RYQHIMPAPSPLIPGGNQNQPAG 58
            |..|::.|| |:::.:|...|....:...:..::.       ..||...||||.:    :.:...
 Frog   266 KRRNSSNKSVTSLTITVRPKNTILVSAKTTQNEVILKRCAPVHQQHNYAAPSPYV----ETEEVA 326

  Fly    59 TMPIKTRKYTPRGMALTRCSESVSSLSP--GSSPAPYNVDQSQSVQRRNAR--ERNRVKQVNNSF 119
            ....|.:...||         .|.|:.|  ..|.:|.|.|...|.:|||..  ||.|...:.:||
 Frog   327 PPQKKQKNELPR---------LVKSVVPTKAKSSSPRNYDSEDSERRRNHNILERQRRNDLRSSF 382

  Fly   120 ARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRL 162
            ..||.|:|:.|           .::|.:||..|:.|.||:..|
 Frog   383 LTLRDHVPELI-----------KNEKAAKVVILKKATEYVHSL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 19/60 (32%)
mycnNP_001006874.1 Myc_N 2..353 CDD:307275 20/99 (20%)
HLH 360..416 CDD:238036 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.