DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ASCL2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:305 Identity:76/305 - (24%)
Similarity:105/305 - (34%) Gaps:124/305 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MPAPSPLIPGGNQNQPAGTMPIK-TRKYTPRGMALTRCS--ESVSSLSPGSSPAPYNVDQSQSVQ 102
            :|..:|         ||..:|:. ..:..|....|.|||  ...::...|...|        :|.
Human     6 LPRSAP---------PAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAA--------AVA 53

  Fly   103 RRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVD 167
            |||.|||||||.||..|..||||:|..           |..||:|||:|||.||||||.||.|:.
Human    54 RRNERERNRVKLVNLGFQALRQHVPHG-----------GASKKLSKVETLRSAVEYIRALQRLLA 107

  Fly   168 DLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNH 232
            :.:...|..|.....|   .:..|:......:|            .::.||              
Human   108 EHDAVRNALAGGLRPQ---AVRPSAPRGPPGTT------------PVAASP-------------- 143

  Fly   233 QPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFNSSMSFDSGTYEGVPQQISTHLDR 297
               :..|.:....|:|.||                ||.|:::|.   |||. ||.          
Human   144 ---SRASSSPGRGGSSEPG----------------SPRSAYSSD---DSGC-EGA---------- 175

  Fly   298 LDHLDNELHTHSQLQLKFEPYEHFQLDEEDCTPDDEEILDYISLW 342
                                          .:|.:.|:||: |.|
Human   176 ------------------------------LSPAERELLDF-SSW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 31/57 (54%)
ASCL2NP_005161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..56 4/26 (15%)
HLH 66..108 CDD:197674 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..177 19/150 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158187
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5142
Isobase 1 0.950 - 0 Normalized mean entropy S6123
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.