DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ASCL1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_004307.2 Gene:ASCL1 / 429 HGNCID:738 Length:236 Species:Homo sapiens


Alignment Length:187 Identity:61/187 - (32%)
Similarity:93/187 - (49%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SPLIPGGNQNQPAG----TMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQ--SVQR 103
            :|.:......||:|    :.|.:.::.......|.||...::....|     |::.|.|  :|.|
Human    63 APQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFG-----YSLPQQQPAAVAR 122

  Fly   104 RNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDD 168
            ||.|||||||.||..||.||:|:|..           ..:||:|||:|||.||||||.||.|:|:
Human   123 RNERERNRVKLVNLGFATLREHVPNG-----------AANKKMSKVETLRSAVEYIRALQQLLDE 176

  Fly   169 LNGGSNIGANNAVTQL-QLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQ 224
            .:      |.:|..|. .|....|.::|:..::.:.|..::|..:..|..||..::|
Human   177 HD------AVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 30/57 (53%)
ASCL1NP_004307.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 6/34 (18%)
bHLH_TS_ASCL1_Mash1 115..185 CDD:381585 40/86 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.