DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Fer3

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:208 Identity:51/208 - (24%)
Similarity:79/208 - (37%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PSPLIPGGNQNQPAG-------------TMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNV 95
            |.|::|  .|...||             ..|:..::.:..|.|....|.|..:....:|.|    
  Fly    28 PPPIVP--YQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMA---- 86

  Fly    96 DQSQSVQRR--NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEY 158
                  |||  |.|||.|:..:|.:|.:||:.:|....           .|::|:::|||:|:.|
  Fly    87 ------QRRAANIRERRRMFNLNEAFDKLRRKVPTFAY-----------EKRLSRIETLRLAITY 134

  Fly   159 IRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSS-SGHNTYYQNTISVSPLQQQ 222
            |..:.:|   |:|                 ..|:||.|.|....| :||:......|....|...
  Fly   135 IGFMAEL---LSG-----------------TPSNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPA 179

  Fly   223 QQLQR---QQFNH 232
            ...||   ..:||
  Fly   180 AAYQRDFASPYNH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 18/57 (32%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.