DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and LYL1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_005574.2 Gene:LYL1 / 4066 HGNCID:6734 Length:280 Species:Homo sapiens


Alignment Length:200 Identity:48/200 - (24%)
Similarity:71/200 - (35%) Gaps:82/200 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAPSPLIPGGNQNQ-------------PAGTMPIKTRKYTPRGMALTRCSESVSSLSP------- 86
            |.|.|..||..|.:             |.|...|......|.|:|:.  :..:.:|.|       
Human    30 PPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMP--TTELGTLRPPLLQLST 92

  Fly    87 -GSSP---------------------APYNV--------------------DQSQSVQRR---NA 106
             |::|                     .|:::                    .|.|.|.||   |:
Human    93 LGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNS 157

  Fly   107 RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYI----RRLQDLVD 167
            |||.|.:.||.:||.||:.:|.           ..|.:|:||.:.||:|::||    |.|:|...
Human   158 RERWRQQNVNGAFAELRKLLPT-----------HPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAA 211

  Fly   168 DLNGG 172
            .|..|
Human   212 ALAAG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 22/61 (36%)
LYL1NP_005574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 7/29 (24%)
HLH 156..208 CDD:197674 23/62 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..280 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.