DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and nhlh2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_991232.1 Gene:nhlh2 / 402968 ZFINID:ZDB-GENE-040426-1809 Length:122 Species:Danio rerio


Alignment Length:115 Identity:34/115 - (29%)
Similarity:47/115 - (40%) Gaps:44/115 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNA----------RERNRVKQVNN 117
            |||...|  .||||                     .:..:||.|          |||.||:..|.
Zfish    41 KTRALVP--AALTR---------------------EEKRRRRRATAKYRSAHATRERIRVEAFNV 82

  Fly   118 SFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVD 167
            :||.||:.:|.           ..|.||:||::.||:|:.||..|..::|
Zfish    83 AFAELRKLLPT-----------LPPDKKLSKIEILRLAICYISYLNHVLD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 22/67 (33%)
nhlh2NP_991232.1 HLH 66..116 CDD:278439 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.