DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and HLH54F

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:295 Identity:71/295 - (24%)
Similarity:106/295 - (35%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRR--NARERNRVKQVNNSFARL 122
            ||.|.|..:|.........|..||.|  |.|         .|||.  |||||.|::.:::::.||
  Fly     1 MPRKKRSSSPTEFFDDDFDEDASSQS--SQP---------PVQRNAANARERMRMRVLSSAYGRL 54

  Fly   123 RQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLC 187
            :..:|..           .|..|:||:||||:|..||::|...|                     
  Fly    55 KTKLPNI-----------PPDTKLSKLDTLRLATLYIKQLITAV--------------------- 87

  Fly   188 LDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALS---LNTNLVGTSV 249
              |:.|||.:    ....||                  |....||...:..|   |:|:.:..|.
  Fly    88 --ETGSHSQN----HPHNHN------------------QHHSLNHSHSSTTSSEGLDTSHMADSS 128

  Fly   250 PGGDAGCVST-----------SKNQQTCHSPTSSFNSSMSFDSGTY--EGVPQQI--STHL--DR 297
            .||:....:.           ..::....:|:||..||...|..|.  :..|:..  .||:  |.
  Fly   129 GGGNYNFHNNGHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADL 193

  Fly   298 LDHLDNELHTHSQLQLKFEPYEHFQLD-EEDCTPD 331
            ..|...|.|:|      :.|.|..|:: ...|:.|
  Fly   194 SYHQLPESHSH------WYPAEVHQMEPAASCSYD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 20/57 (35%)
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.