powered by:
Protein Alignment sc and Ferd3l
DIOPT Version :9
Sequence 1: | NP_476803.1 |
Gene: | sc / 30982 |
FlyBaseID: | FBgn0004170 |
Length: | 345 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102450.1 |
Gene: | Ferd3l / 366598 |
RGDID: | 1311812 |
Length: | 166 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 36/65 - (55%) |
Gaps: | 11/65 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 QRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLV 166
|..|.|||.|:..:|.:|.:||:.:|.... .|::|:::|||:|:.||..:.:|:
Rat 104 QAANIRERKRMFNLNEAFDQLRRKVPTFAY-----------EKRLSRIETLRLAIVYISFMTELL 157
Fly 167 166
Rat 158 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
sc | NP_476803.1 |
HLH |
105..163 |
CDD:278439 |
18/57 (32%) |
Ferd3l | NP_001102450.1 |
HLH |
102..154 |
CDD:278439 |
19/60 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.