DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Bhlha9

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_038943763.1 Gene:Bhlha9 / 363656 RGDID:1311234 Length:230 Species:Rattus norvegicus


Alignment Length:68 Identity:23/68 - (33%)
Similarity:34/68 - (50%) Gaps:14/68 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SQSVQRR---NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYI 159
            ::|..||   |.|||.|:...|.:|..||:.:...:       ||    |::||:.|||.|:..|
  Rat    56 ARSKARRMAANVRERKRILDYNEAFNALRRALQHDL-------GG----KRLSKIATLRRAIHRI 109

  Fly   160 RRL 162
            ..|
  Rat   110 TAL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 20/58 (34%)
Bhlha9XP_038943763.1 bHLH_TS_bHLHa9 54..116 CDD:381482 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.