powered by:
Protein Alignment sc and Bhlha9
DIOPT Version :9
Sequence 1: | NP_476803.1 |
Gene: | sc / 30982 |
FlyBaseID: | FBgn0004170 |
Length: | 345 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038943763.1 |
Gene: | Bhlha9 / 363656 |
RGDID: | 1311234 |
Length: | 230 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 23/68 - (33%) |
Similarity: | 34/68 - (50%) |
Gaps: | 14/68 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 SQSVQRR---NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYI 159
::|..|| |.|||.|:...|.:|..||:.:...: || |::||:.|||.|:..|
Rat 56 ARSKARRMAANVRERKRILDYNEAFNALRRALQHDL-------GG----KRLSKIATLRRAIHRI 109
Fly 160 RRL 162
..|
Rat 110 TAL 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.