DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and FIGLA

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001004311.2 Gene:FIGLA / 344018 HGNCID:24669 Length:219 Species:Homo sapiens


Alignment Length:248 Identity:66/248 - (26%)
Similarity:93/248 - (37%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAPSPLIPGGNQNQPAGT------MPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQS 100
            |||..|.|........||      ..:...::.|.......|  .:..|..|...:..|: |...
Human     3 PAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVC--RLKRLPSGGYSSTENL-QLVL 64

  Fly   101 VQRR--NARERNRVKQVNNSFARLR---QHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIR 160
            .:||  ||:||.|:|.:|..||||:   ..:|||              :|.||||.|:.|.|||:
Human    65 ERRRVANAKERERIKNLNRGFARLKALVPFLPQS--------------RKPSKVDILKGATEYIQ 115

  Fly   161 RLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQL 225
            .|.||::        ||.::..|..   ||.|..::||.:.:||.                 :||
Human   116 VLSDLLE--------GAKDSKKQDP---DEQSYSNNSSESHTSSA-----------------RQL 152

  Fly   226 QRQQFNHQPLTALSLNTNLVGTSVPGGDA----GCVSTSKNQQTCHSPTSSFN 274
            .|....|.. .|..|.....|....||..    .|..:..:.....|||.|.:
Human   153 SRNITQHIS-CAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/60 (40%)
FIGLANP_001004311.2 HLH 65..122 CDD:238036 29/70 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..151 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.