DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and MSGN1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:189 Identity:46/189 - (24%)
Similarity:70/189 - (37%) Gaps:63/189 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTTINSATKIFRYQHIMPAPS---------PLIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSES 80
            |..:|.|:.   .|.:.||||         |.:.|         :|.:      .|.|.:..||.
Human    35 PFELNQASP---SQSLSPAPSLESYSSSPCPAVAG---------LPCE------HGGASSGGSEG 81

  Fly    81 VS--------------------SLSPGSSP-APYNVDQSQSVQRR---NARERNRVKQVNNSFAR 121
            .|                    .|..|..| |........|||||   :.||:.|::.:.::...
Human    82 CSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHT 146

  Fly   122 LRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNA 180
            ||.::|...       ..||  :.::|:.||:..::||..|.||   ||.|....|.:|
Human   147 LRNYLPPVY-------SQRG--QPLTKIQTLKYTIKYIGELTDL---LNRGREPRAQSA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 13/57 (23%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59 8/26 (31%)
HLH 125..179 CDD:278439 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.