DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and HLH4C

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:196 Identity:47/196 - (23%)
Similarity:75/196 - (38%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKY 67
            ||.:.......:|:.|..::.|...:...|.      ..|||.|        .|.   |...|:.
  Fly    33 NNPHLVNEDYAASTTLDIDKRFQARMACETA------AQPAPPP--------PPT---PAPRRRT 80

  Fly    68 TPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNA----------RERNRVKQVNNSFARL 122
            ||           ::.|.|...   ..:.:.:..:||.|          |||.||:..|.|||.|
  Fly    81 TP-----------IAHLDPSEL---VGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAEL 131

  Fly   123 RQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLC 187
            |:.:|.           ..|.||:||::.|::|:.||..|..:::  ....:.||::..|.   |
  Fly   132 RKLLPT-----------LPPDKKLSKIEILKLAICYIAYLNHVLE--TPXDSAGASSFATS---C 180

  Fly   188 L 188
            |
  Fly   181 L 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 22/67 (33%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.