DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and l(1)sc

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster


Alignment Length:320 Identity:110/320 - (34%)
Similarity:145/320 - (45%) Gaps:108/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QHIMPAPSPLIPGG-------NQNQPAGTMPI---KTRKYTPRGMALTRCSESVSSLSPGSSPAP 92
            ||.:.||.  ||.|       .|:|.:...|:   :.:|:....|                   |
  Fly    34 QHQLIAPK--IPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYNNM-------------------P 77

  Fly    93 YNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVE 157
            |. :|..||.|||||||||||||||.|..||||:||:::..|: .||||..||:|||||||||||
  Fly    78 YG-EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLS-NGGRGSSKKLSKVDTLRIAVE 140

  Fly   158 YIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQ 222
            |||.|||::||       |..::...:....||||:..||        :|.|..:..|       
  Fly   141 YIRGLQDMLDD-------GTASSTRHIYNSADESSNDGSS--------YNDYNDSLDS------- 183

  Fly   223 QQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCH--SPTSSFNSSMSFDSGTYE 285
                .|||             |.|          .:.|....:.|  |||.|::.| ....|.| 
  Fly   184 ----SQQF-------------LTG----------ATQSAQSHSYHSASPTPSYSGS-EISGGGY- 219

  Fly   286 GVPQQISTHLDRLDHLDNELHTHSQLQLKFEPYEHFQLDEEDCTPDDEEILDYISLWQEQ 345
             :.|::                 .:..|||:.::.|. ||:   |||||:|||||.||||
  Fly   220 -IKQEL-----------------QEQDLKFDSFDSFS-DEQ---PDDEELLDYISSWQEQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 41/57 (72%)
l(1)scNP_476623.1 HLH <96..146 CDD:278439 34/50 (68%)
Peptidase_C11 <128..218 CDD:304483 42/139 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448492
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm6567
orthoMCL 1 0.900 - - OOG6_114727
Panther 1 1.100 - - P PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.