DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ac

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:278 Identity:99/278 - (35%)
Similarity:126/278 - (45%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLT- 135
            |||...:.||.:....||.| :|   ..||.|||||||||||||||.|::||||||.::|.||: 
  Fly     1 MALGSENHSVFNDDEESSSA-FN---GPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSN 61

  Fly   136 --KGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSS 198
              :|.|.|.:||:|||.||::|||||||||.::.:         |:...|.||.|.:...|    
  Fly    62 GRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHE---------NDQQKQKQLHLQQQHLH---- 113

  Fly   199 STCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQ 263
                                .|||||.|.....||.|...|          |.|.          
  Fly   114 --------------------FQQQQQHQHLYAWHQELQLQS----------PTGS---------- 138

  Fly   264 QTCHSPTSSFNSSMSFDSGTYEGVPQQISTHLDRLDHLDNELHTHSQLQLKFEPYEHFQLDEEDC 328
                  |||.||..|:.......:|....         .|..||  :|:..||.|.:     ..|
  Fly   139 ------TSSCNSISSYCKPATSTIPGATP---------PNNFHT--KLEASFEDYRN-----NSC 181

  Fly   329 T--PDDEEILDYISLWQE 344
            :  .:||:|||||||||:
  Fly   182 SSGTEDEDILDYISLWQD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 40/60 (67%)
acNP_476824.1 HLH 30..96 CDD:197674 42/65 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467874
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm6567
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.