DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ascl1a

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:199 Identity:65/199 - (32%)
Similarity:97/199 - (48%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QHIMPAPS--------PLIPGGNQ--NQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAP 92
            |..|| |:        .|.|..:|  |:.|.....:.|..:|.   |.||...::....|     
Zfish    14 QQFMP-PACFFASQSIQLSPTDSQCSNKSASKQAKRQRSSSPE---LLRCKRRLNFAGFG----- 69

  Fly    93 YNVDQSQ--SVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIA 155
            |::.|.|  :|.|||.|||||||.|||.||.||:|:|..           ..:||:|||:|||.|
Zfish    70 YSLPQQQPHAVARRNERERNRVKLVNNGFATLREHVPNG-----------AANKKMSKVETLRSA 123

  Fly   156 VEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQ 220
            |||||.||.|:|:.:..|....:..::.     ..|.::|:..::.:.|..::|..:..|..||.
Zfish   124 VEYIRALQQLLDEHDAVSAAFQSGVLSP-----TISQNYSNDMNSMAGSPVSSYSSDEGSYDPLS 183

  Fly   221 QQQQ 224
            .::|
Zfish   184 PEEQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 31/57 (54%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54 4/20 (20%)
HLH 94..136 CDD:197674 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594069
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5117
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm6567
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.